PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07094A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 298aa    MW: 32863.9 Da    PI: 9.5387
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07094AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.54e-103176347
                               SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47
                                WT++E +l+ +a +       +W+++a+ ++ gRt +++ s+++++
  Oropetium_20150105_07094A 31 VWTPQENKLFEQALAAVDLAhpDWHKVAQAIP-GRTVNEVMSHYRSL 76
                               6*************98776566**********.***********986 PP

2Myb_DNA-binding44.83e-14145189347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT+eE+ +++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  Oropetium_20150105_07094A 145 PWTEEEHRQFLLGLKKYGKGDWRNISRNFVHTRTPTQVASHAQKY 189
                                8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.2492781IPR017884SANT domain
SMARTSM007174.2E-72879IPR001005SANT/Myb domain
SuperFamilySSF466894.16E-103081IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-63176IPR009057Homeodomain-like
PfamPF002492.3E-83176IPR001005SANT/Myb domain
CDDcd001672.73E-83277No hitNo description
PROSITE profilePS5129419.158138194IPR017930Myb domain
SuperFamilySSF466896.06E-18139194IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-17141192IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.2E-12142188IPR009057Homeodomain-like
SMARTSM007173.5E-13142192IPR001005SANT/Myb domain
CDDcd001671.93E-11145190No hitNo description
PfamPF002493.9E-12145189IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MMREAYMEVL QPMDHYASRN NCNWFLGAPR VWTPQENKLF EQALAAVDLA HPDWHKVAQA  60
IPGRTVNEVM SHYRSLVVDV HQIESGVVPL PVYGGGGGAN SFTLQWDGNG GHGVGDFRHG  120
YRFAGGCGKR HPGRTLEQER KKGVPWTEEE HRQFLLGLKK YGKGDWRNIS RNFVHTRTPT  180
QVASHAQKYF IRLNSGGKDK RRSSIHDITT VNLNDDQPPS PSRSSLITNQ PNASAPTPVV  240
SQFSLTADTK QHGAANMPFN SPSRAPGIPA YAMGLQDQGL QCGPIHDQLI ANTSILL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-152798678RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968168.11e-167PREDICTED: transcription factor DIVARICATA
TrEMBLA5HJS50.0A5HJS5_9POAL; MYB_Al protein
STRINGSi002426m1e-167(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.14e-78MYB family protein